Q8NFD5 (ARI1B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
July 24, 2013.
Version 110.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: AT-rich interactive domain-containing protein 1B Short name=ARID domain-containing protein 1B Alternative name(s): BRG1-associated factor 250b Short name=BAF250B BRG1-binding protein hELD/OSA1 Osa homolog 2 Short name=hOsa2 p250R | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 2236 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth By similarity. Binds DNA non-specifically. |
| Subunit structure | Component of SWI/SNF chromatin remodeling complexes, in some of which it can be mutually exclusive with ARID1A/BAF250A. Component of the BAF (SWI/SNF-A) complex, which includes at least actin (ACTB), ARID1A, ARID1B/BAF250, SMARCA2, SMARCA4/BRG1/BAF190A, ACTL6A/BAF53, ACTL6B/BAF53B, SMARCE1/BAF57, SMARCC1/BAF155, SMARCC2/BAF170, SMARCB1/SNF5/INI1, and one or more of SMARCD1/BAF60A, SMARCD2/BAF60B, or SMARCD3/BAF60C. In muscle cells, the BAF complex also contains DPF3. Component of the SWI/SNF-B (PBAF) complex, at least composed of SMARCA4/BRG1/BAF190A, SMARCB1/BAF47, ACTL6A/BAF53A or ACTL6B/BAF53B, SMARCE1/BAF57, SMARCD1/BAF60A, SMARCD2/BAF60B, perhaps SMARCD3/BAF60C, SMARCC1/BAF155, SMARCC2/BAF170, PB1/BAF180, ARID2/BAF200, ARID1A/BAF250A or ARID1B/BAF250B and actin. Component of a SWI/SNF-like EPAFb complex, at least composed of SMARCA4/BRG1/BAF190A, SMARCB1/BAF47, ACTL6A/BAF53A, SMARCE1/BAF57, SMARCD1/BAF60A, SMARCD2/BAF60B, SMARCC1/BAF155, SMARCC2/BAF170, ARID1B/BAF250B, MLLT1/ENL and actin. Component of a SWI/SNF-like complex containing ARID1A/BAF250A and ARID1B/BAF250B. Interacts through its C-terminus with SMARCA2/BRM/BAF190B and SMARCA4/BRG1/BAF190A. Interacts with SMARCC1/BAF155. Component of neural progenitors-specific chromatin remodeling complex (npBAF complex) composed of at least, ARID1A/BAF250A or ARID1B/BAF250B, SMARCD1/BAF60A, SMARCD3/BAF60C, SMARCA2/BRM/BAF190B, SMARCA4/BRG1/BAF190A, SMARCB1/BAF47, SMARCC1/BAF155, SMARCE1/BAF57, SMARCC2/BAF170, PHF10/BAF45A, ACTL6A/BAF53A and actin. Component of neuron-specific chromatin remodeling complex (nBAF complex) composed of at least, ARID1A/BAF250A or ARID1B/BAF250B, SMARCD1/BAF60A, SMARCD3/BAF60C, SMARCA2/BRM/BAF190B, SMARCA4/BRG1/BAF190A, SMARCB1/BAF47, SMARCC1/BAF155, SMARCE1/BAF57, SMARCC2/BAF170, DPF1/BAF45B, DPF3/BAF45C, ACTL6B/BAF53B and actin By similarity. Ref.1 Ref.5 Ref.6 Ref.7 Ref.19 Ref.21 |
| Subcellular location | |
| Tissue specificity | Widely expressed with high levels in heart, skeletal muscle and kidney. Ref.5 Ref.6 Ref.7 |
| Polymorphism | The poly-Gln region is polymorphic and the number of Gln varies in the population (from 17 to 23). |
| Involvement in disease | Mental retardation, autosomal dominant 12 (MRD12) [MIM:614562]: A disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. MRD12 patients present with moderate to severe psychomotor retardation, and most show evidence of muscular hypotonia. In many patients, expressive speech is more severely affected than receptive function. Additional common findings include short stature, abnormal head shape and low-set, posteriorly rotated, and abnormally shaped ears, downslanting palpebral fissures, a bulbous nasal tip, a thin upper lip, minor teeth anomalies, and brachydactyly or single palmar creases. Autistic features are uncommon. |
| Sequence similarities | Contains 1 ARID domain. |
| Caution | It is uncertain whether Met-1 or Met-59 is the initiator. |
| Sequence caution | The sequence AAL76077.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAN70985.1 differs from that shown. Reason: Frameshift at positions 857 and 863. The sequence CAA69592.1 differs from that shown. Reason: Frameshift at position 132. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Neurogenesis Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism Triplet repeat expansion |
| Disease | Mental retardation |
| Ligand | DNA-binding |
| Molecular function | Chromatin regulator |
| PTM | Acetylation Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | chromatin-mediated maintenance of transcription Non-traceable author statement Ref.1. Source: UniProtKB nervous system developmentInferred from electronic annotation. Source: UniProtKB-KW transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | SWI/SNF complex Inferred from direct assay Ref.1. Source: UniProtKB |
| Molecular_function | DNA binding Inferred from direct assay Ref.19. Source: GDB transcription coactivator activityNon-traceable author statement Ref.1. Source: UniProtKB |
| Complete GO annotation... |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| SMARCA2 | P51531 | 3 | EBI-679921,EBI-679562 | |
| SMARCA4 | P51532 | 3 | EBI-679921,EBI-302489 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] |
| Isoform 1 (identifier: Q8NFD5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. |
| Isoform 2 (identifier: Q8NFD5-2) The sequence of this isoform differs from the canonical sequence as follows: 579-579: Q → QDSGDATWKETFWL |
| Isoform 3 (identifier: Q8NFD5-3) The sequence of this isoform differs from the canonical sequence as follows: 1032-1032: K → KDSYSSQGISQPPTPGNLPVPSPMSPSSASISSFHGDESDSISSPGWPKTPSSP |
| Isoform 4 (identifier: Q8NFD5-4) The sequence of this isoform differs from the canonical sequence as follows: 1-750: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||
Molecule processing | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed | ||||||||||||||
| Chain | 2 – 2236 | 2235 | AT-rich interactive domain-containing protein 1B | PRO_0000200576 | |||||||||||||
Regions | |||||||||||||||||
| Domain | 1053 – 1144 | 92 | ARID | ||||||||||||||
| Motif | 419 – 423 | 5 | LXXLL | ||||||||||||||
| Motif | 2036 – 2040 | 5 | LXXLL | ||||||||||||||
| Compositional bias | 2 – 47 | 46 | Ala-rich | ||||||||||||||
| Compositional bias | 35 – 57 | 23 | Ser-rich | ||||||||||||||
| Compositional bias | 81 – 104 | 24 | His-rich | ||||||||||||||
| Compositional bias | 107 – 131 | 25 | Gln-rich | ||||||||||||||
| Compositional bias | 114 – 131 | 18 | Poly-Gln | ||||||||||||||
| Compositional bias | 141 – 401 | 261 | Gly-rich | ||||||||||||||
| Compositional bias | 329 – 493 | 165 | Ala-rich | ||||||||||||||
| Compositional bias | 574 – 633 | 60 | Gln-rich | ||||||||||||||
| Compositional bias | 684 – 771 | 88 | Ser-rich | ||||||||||||||
| Compositional bias | 932 – 935 | 4 | Poly-Ala | ||||||||||||||
| Compositional bias | 1034 – 1037 | 4 | Poly-Ser | ||||||||||||||
| Compositional bias | 1441 – 1444 | 4 | Poly-Ser | ||||||||||||||
| Compositional bias | 1459 – 1597 | 139 | Pro-rich | ||||||||||||||
| Compositional bias | 1833 – 1836 | 4 | Poly-Pro | ||||||||||||||
Amino acid modifications | |||||||||||||||||
| Modified residue | 2 | 1 | N-acetylalanine | ||||||||||||||
| Modified residue | 516 | 1 | Phosphoserine Ref.9 | ||||||||||||||
| Modified residue | 1555 | 1 | Phosphoserine Ref.9 Ref.13 Ref.14 | ||||||||||||||
| Modified residue | 1559 | 1 | Phosphoserine Ref.9 Ref.13 | ||||||||||||||
| Modified residue | 1715 | 1 | Phosphoserine Ref.14 | ||||||||||||||
| Modified residue | 1777 | 1 | N6-acetyllysine Ref.12 | ||||||||||||||
Natural variations | |||||||||||||||||
| Alternative sequence | 1 – 750 | 750 | Missing in isoform 4. | VSP_040800 | |||||||||||||
| Alternative sequence | 579 | 1 | Q → QDSGDATWKETFWL in isoform 2. | VSP_015226 | |||||||||||||
| Alternative sequence | 1032 | 1 | K → KDSYSSQGISQPPTPGNLPV PSPMSPSSASISSFHGDESD SISSPGWPKTPSSP in isoform 3. | VSP_015227 | |||||||||||||
| Natural variant | 11 | 1 | A → AA. Ref.15 | VAR_067662 | |||||||||||||
| Natural variant | 45 – 47 | 3 | Missing. | VAR_067663 | |||||||||||||
| Natural variant | 82 | 1 | Q → H. Ref.15 | VAR_067664 | |||||||||||||
| Natural variant | 246 | 1 | G → S. Ref.15 | VAR_067665 | |||||||||||||
| Natural variant | 318 – 319 | 2 | Missing. | VAR_067666 | |||||||||||||
| Natural variant | 319 | 1 | Missing. Ref.15 | VAR_067667 | |||||||||||||
| Natural variant | 327 – 328 | 2 | Missing. | VAR_067668 | |||||||||||||
| Natural variant | 333 – 337 | 5 | Missing. | VAR_067669 | |||||||||||||
| Natural variant | 363 | 1 | A → V. Ref.15 | VAR_067670 | |||||||||||||
| Natural variant | 396 | 1 | G → A. Ref.15 | VAR_067671 | |||||||||||||
| Natural variant | 429 | 1 | M → V. Ref.15 | VAR_067672 | |||||||||||||
| Natural variant | 450 | 1 | P → PP. Ref.15 | VAR_067673 | |||||||||||||
| Natural variant | 497 | 1 | S → N. Ref.15 | VAR_067674 | |||||||||||||
| Natural variant | 531 | 1 | M → T. Ref.15 | VAR_067675 | |||||||||||||
| Natural variant | 814 | 1 | G → A in a breast cancer sample; somatic mutation. Ref.23 | VAR_036257 | |||||||||||||
| Natural variant | 876 | 1 | Q → E. Ref.15 | VAR_067676 | |||||||||||||
| Natural variant | 980 | 1 | Q → L. Ref.15 | VAR_067677 | |||||||||||||
| Natural variant | 1092 | 1 | V → I. Ref.15 | VAR_067678 | |||||||||||||
| Natural variant | 1249 | 1 | Q → P. Ref.15 | VAR_067679 | |||||||||||||
| Natural variant | 1271 | 1 | G → E. Ref.15 | VAR_067680 | |||||||||||||
| Natural variant | 1303 | 1 | G → R. Ref.15 | VAR_067681 | |||||||||||||
| Natural variant | 1321 | 1 | S → N. Ref.15 | VAR_067682 | |||||||||||||
| Natural variant | 1411 | 1 | P → S. Ref.15 | VAR_067683 | |||||||||||||
| Natural variant | 1466 | 1 | Q → K. Ref.15 | VAR_067684 | |||||||||||||
| Natural variant | 1506 | 1 | R → H. Ref.15 | VAR_067685 | |||||||||||||
| Natural variant | 1573 | 1 | T → M. Ref.15 | VAR_067686 | |||||||||||||
| Natural variant | 1659 | 1 | N → S. Ref.15 | VAR_067687 | |||||||||||||
| Natural variant | 1733 | 1 | Missing. Ref.15 | VAR_067688 | |||||||||||||
| Natural variant | 1773 | 1 | K → R. Ref.15 | VAR_067689 | |||||||||||||
| Natural variant | 1851 | 1 | D → N. Ref.15 | VAR_067690 | |||||||||||||
| Natural variant | 1898 | 1 | K → R. Ref.15 | VAR_067691 | |||||||||||||
| Natural variant | 1954 | 1 | K → R. Ref.15 | VAR_067692 | |||||||||||||
| Natural variant | 2163 | 1 | Q → R. Ref.15 | VAR_067693 | |||||||||||||
Experimental info | |||||||||||||||||
| Sequence conflict | 334 – 336 | 3 | AGA → SRS in AAN03447. Ref.5 | ||||||||||||||
| Sequence conflict | 446 | 1 | P → A in AAN70985. Ref.6 | ||||||||||||||
| Sequence conflict | 687 | 1 | V → A in AAL76077. Ref.7 | ||||||||||||||
| Sequence conflict | 904 | 1 | T → P in AAL76077. Ref.7 | ||||||||||||||
| Sequence conflict | 1201 | 1 | T → I in AAG36928. Ref.1 | ||||||||||||||
| Sequence conflict | 1339 | 1 | P → S in AAN70985. Ref.6 | ||||||||||||||
| Sequence conflict | 1432 | 1 | P → L in BAA86549. Ref.8 | ||||||||||||||
| Sequence conflict | 1534 | 1 | P → S in AAN70985. Ref.6 | ||||||||||||||
| Sequence conflict | 1713 | 1 | D → N in AAL76077. Ref.7 | ||||||||||||||
| Sequence conflict | 2196 | 1 | D → N in AAG36928. Ref.1 | ||||||||||||||
Secondary structure | |||||||||||||||||
Helix Strand Turn | |||||||||||||||||
| Helix | 1046 – 1049 | 4 | |||||||||||||||
| Helix | 1056 – 1070 | 15 | |||||||||||||||
| Helix | 1087 – 1097 | 11 | |||||||||||||||
| Helix | 1100 – 1106 | 7 | |||||||||||||||
| Helix | 1109 – 1115 | 7 | |||||||||||||||
| Helix | 1122 – 1135 | 14 | |||||||||||||||
| Helix | 1137 – 1145 | 9 |
Sequences
|
References
| « Hide 'large scale' references | |
| [1] | "SYT associates with human SNF/SWI complexes and the C-terminal region of its fusion partner SSX1 targets histones." Kato H., Tjernberg A., Zhang W., Krutchinsky A.N., An W., Takeuchi T., Ohtsuki Y., Sugano S., de Bruijn D.R., Chait B.T., Roeder R.G. J. Biol. Chem. 277:5498-5505(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), IDENTIFICATION IN THE EPAFB COMPLEX. Tissue: Brain. |
| [2] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "New 5'-(CGG)-3' repeats in the human genome." Mangel L., Ternes T., Schmitz B., Doerfler W. J. Biol. Chem. 273:30466-30471(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-515. |
| [4] | "Cloning of the gene for spinocerebellar ataxia 2 reveals a locus with high sensitivity to expanded CAG/glutamine repeats." Imbert G., Saudou F., Yvert G., Devys D., Trottier Y., Garnier J.-M., Weber C., Mandel J.-L., Cancel G., Abbas N., Duerr A., Didierjean O., Stevanin G., Agid Y., Brice A. Nat. Genet. 14:285-291(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 9-199. |
| [5] | "Largest subunits of the human SWI/SNF chromatin-remodeling complex promote transcriptional activation by steroid hormone receptors." Inoue H., Furukawa T., Giannakopoulos S., Zhou S., King D.S., Tanese N. J. Biol. Chem. 277:41674-41685(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 72-2236 (ISOFORM 1), TISSUE SPECIFICITY, INTERACTION WITH SMARCA2 AND SMARCA4, IDENTIFICATION IN A SWI/SNF-LIKE COMPLEX WITH ARID1A. |
| [6] | "Novel SWI/SNF chromatin-remodeling complexes contain a mixed-lineage leukemia chromosomal translocation partner." Nie Z., Yan Z., Chen E.H., Sechi S., Ling C., Zhou S., Xue Y., Yang D., Murray D., Kanakubo E., Cleary M.L., Wang W. Mol. Cell. Biol. 23:2942-2952(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 272-2236 (ISOFORM 1), TISSUE SPECIFICITY, MASS SPECTROMETRY, IDENTIFICATION IN A SWI/SNF-LIKE EPAFB COMPLEX. |
| [7] | "Cloning and characterization of hELD/OSA1, a novel BRG1 interacting protein." Hurlstone A.F., Olave I.A., Barker N., van Noort M., Clevers H. Biochem. J. 364:255-264(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 491-2236 (ISOFORM 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INTERACTION WITH SMARCA4, IDENTIFICATION IN A COMPLEX WITH SMARCA4 AND SMARCD1, IDENTIFICATION IN A SWI/SNF-LIKE COMPLEX WITH ARID1A. |
| [8] | "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O. DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 705-2236 (ISOFORM 3). Tissue: Brain. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-516; SER-1555 AND SER-1559, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, MASS SPECTROMETRY, CLEAVAGE OF INITIATOR METHIONINE. |
| [11] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Leukemic T-cell. |
| [12] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-1777, MASS SPECTROMETRY. |
| [13] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1555 AND SER-1559, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [14] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1555 AND SER-1715, MASS SPECTROMETRY. |
| [15] | "Haploinsufficiency of ARID1B, a member of the SWI/SNF-a chromatin-remodeling complex, is a frequent cause of intellectual disability." Hoyer J., Ekici A.B., Endele S., Popp B., Zweier C., Wiesener A., Wohlleber E., Dufke A., Rossier E., Petsch C., Zweier M., Gohring I., Zink A.M., Rappold G., Schrock E., Wieczorek D., Riess O., Engels H., Rauch A., Reis A. Am. J. Hum. Genet. 90:565-572(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN MRD12, VARIANTS ALA-11 INS; 45-ALA--ALA-47 DEL; HIS-82; SER-246; 318-GLY-GLY-319 DEL; GLY-319 DEL; 327-GLY-GLY-328 DEL; 333-GLY--GLY-337 DEL; VAL-363; ALA-396; VAL-429; PRO-450 INS; ASN-497; THR-531; GLU-876; LEU-980; ILE-1092; PRO-1249; GLU-1271; ARG-1303; ASN-1321; SER-1411; LYS-1466; HIS-1506; MET-1573; SER-1659; GLU-1733 DEL; ARG-1773; ASN-1851; ARG-1898; ARG-1954 AND ARG-2163. |
| [16] | "Mutations affecting components of the SWI/SNF complex cause Coffin-Siris syndrome." Tsurusaki Y., Okamoto N., Ohashi H., Kosho T., Imai Y., Hibi-Ko Y., Kaname T., Naritomi K., Kawame H., Wakui K., Fukushima Y., Homma T., Kato M., Hiraki Y., Yamagata T., Yano S., Mizuno S., Sakazume S. Matsumoto N.Nat. Genet. 44:376-378(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN MRD12. |
| [17] | "Mutations in SWI/SNF chromatin remodeling complex gene ARID1B cause Coffin-Siris syndrome." Santen G.W., Aten E., Sun Y., Almomani R., Gilissen C., Nielsen M., Kant S.G., Snoeck I.N., Peeters E.A., Hilhorst-Hofstee Y., Wessels M.W., den Hollander N.S., Ruivenkamp C.A., van Ommen G.J., Breuning M.H., den Dunnen J.T., van Haeringen A., Kriek M. Nat. Genet. 44:379-380(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN MRD12. |
| [18] | "Recent advances in understanding chromatin remodeling by SWI/SNF complexes." Martens J.A., Winston F. Curr. Opin. Genet. Dev. 13:136-142(2003) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON SWI/SNF CHROMATIN REMODELING COMPLEXES. |
| [19] | "Two related ARID family proteins are alternative subunits of human SWI/SNF complexes." Wang X., Nagl N.G., Wilsker D., Van Scoy M., Pacchione S., Yaciuk P., Dallas P.B., Moran E. Biochem. J. 383:319-325(2004) [PubMed] [Europe PMC] [Abstract] Cited for: DNA-BINDING, IDENTIFICATION IN SWI/SNF COMPLEXES, INTERACTION WITH SMARCA2; SMARCA4 AND SMARCC1. |
| [20] | "The DNA-binding properties of the ARID-containing subunits of yeast and mammalian SWI/SNF complexes." Wilsker D., Patsialou A., Zumbrun S.D., Kim S., Chen Y., Dallas P.B., Moran E. Nucleic Acids Res. 32:1345-1353(2004) [PubMed] [Europe PMC] [Abstract] Cited for: DNA-BINDING. |
| [21] | "Regulation of muscle development by DPF3, a novel histone acetylation and methylation reader of the BAF chromatin remodeling complex." Lange M., Kaynak B., Forster U.B., Toenjes M., Fischer J.J., Grimm C., Schlesinger J., Just S., Dunkel I., Krueger T., Mebus S., Lehrach H., Lurz R., Gobom J., Rottbauer W., Abdelilah-Seyfried S., Sperling S. Genes Dev. 22:2370-2384(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE BAF COMPLEX, IDENTIFICATION BY MASS SPECTROMETRY. |
| [22] | "Crystal structure of the HBAF250B AT-rich interaction domain (ARID)." RIKEN structural genomics initiative (RSGI) Submitted (OCT-2006) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (1.6 ANGSTROMS) OF 1041-1159. |
| [23] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] ALA-814. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF259792 mRNA. Translation: AAG36928.1. AL355297 AL591545 Genomic DNA. Translation: CAH71534.1.AL049820 AL591545 Genomic DNA. Translation: CAI42308.1.AL162578 AL591545 Genomic DNA. Translation: CAI40014.1.AL591545 AL355297 Genomic DNA. Translation: CAI40666.1.AL049820, AL591545 Genomic DNA. Translation: CAI42305.1. AL591545, AL049820 Genomic DNA. Translation: CAI40664.1. AJ001216 Genomic DNA. No translation available. Y08266 mRNA. Translation: CAA69592.1. Frameshift. AF521671 mRNA. Translation: AAN03447.1. AF253515 mRNA. Translation: AAN70985.1. Sequence problems. AF468300 mRNA. Translation: AAL76077.1. Different initiation. AB033061 mRNA. Translation: BAA86549.1. | ||||||||||||||||||
| IPI | IPI00015404. IPI00395617. IPI00396577. IPI00742937. | ||||||||||||||||||
| RefSeq | NP_059989.2. NM_017519.2. NP_065783.3. NM_020732.3. | ||||||||||||||||||
| UniGene | Hs.291587. Hs.744461. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q8NFD5. | ||||||||||||||||||
| SMR | Q8NFD5. Positions 1041-1154. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q8NFD5. 7 interactions. | ||||||||||||||||||
| MINT | MINT-1153351. | ||||||||||||||||||
| STRING | 9606.ENSP00000275248. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q8NFD5. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 73921720. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | Q8NFD5. | ||||||||||||||||||
| PRIDE | Q8NFD5. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000346085; ENSP00000344546; ENSG00000049618. ENST00000350026; ENSP00000055163; ENSG00000049618. ENST00000367148; ENSP00000356116; ENSG00000049618. | ||||||||||||||||||
| GeneID | 57492. | ||||||||||||||||||
| KEGG | hsa:57492. | ||||||||||||||||||
| UCSC | uc003qqn.3. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 57492. | ||||||||||||||||||
| GeneCards | GC06P157191. | ||||||||||||||||||
| H-InvDB | HIX0006320. HIX0165033. | ||||||||||||||||||
| HGNC | HGNC:18040. ARID1B. | ||||||||||||||||||
| HPA | HPA016511. | ||||||||||||||||||
| MIM | 614556. gene. 614562. phenotype. | ||||||||||||||||||
| neXtProt | NX_Q8NFD5. | ||||||||||||||||||
| Orphanet | 251056. 6q25 microdeletion syndrome. 1465. Coffin-Siris syndrome. | ||||||||||||||||||
| PharmGKB | PA134909463. | ||||||||||||||||||
| HUGE | Search... | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | NOG12793. | ||||||||||||||||||
| HOVERGEN | HBG058196. | ||||||||||||||||||
| KO | K11653. | ||||||||||||||||||
| OMA | PIGIQGR. | ||||||||||||||||||
| OrthoDB | EOG4G7BXG. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q8NFD5. | ||||||||||||||||||
| Bgee | Q8NFD5. | ||||||||||||||||||
| CleanEx | HS_ARID1B. | ||||||||||||||||||
| Genevestigator | Q8NFD5. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| Gene3D | 1.10.150.60. 1 hit. 1.25.10.10. 1 hit. | ||||||||||||||||||
| InterPro | IPR001606. ARID/BRIGHT_DNA-bd. IPR011989. ARM-like. IPR021906. DUF3518. [Graphical view] | ||||||||||||||||||
| Pfam | PF01388. ARID. 1 hit. PF12031. DUF3518. 1 hit. [Graphical view] | ||||||||||||||||||
| SMART | SM00501. BRIGHT. 1 hit. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF46774. ARID. 1 hit. | ||||||||||||||||||
| PROSITE | PS51011. ARID. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| EvolutionaryTrace | Q8NFD5. | ||||||||||||||||||
| GeneWiki | ARID1B. | ||||||||||||||||||
| GenomeRNAi | 57492. | ||||||||||||||||||
| NextBio | 63782. | ||||||||||||||||||
| SOURCE | Search... |
Entry information
| Entry name | ARI1B_HUMAN | |||||||
| Accession | Primary (citable) accession number: Q8NFD5 Secondary accession number(s): Q5JRD1 Q9ULI5 | |||||||
| Entry history |
| |||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | |||||||
| Annotation program | Chordata Protein Annotation Program | |||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. |
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |



Clusters with
